Lottia gigantea (owl limpet): LOTGIDRAFT_145453 Help Entry LOTGIDRAFT_145453 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K11253   histone H3 Organism lgi  Lottia gigantea (owl limpet) Brite KEGG Orthology (KO) [BR:lgi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lgi03036]     LOTGIDRAFT_145453   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgi04147]     LOTGIDRAFT_145453 Chromosome and associated proteins [BR:lgi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     LOTGIDRAFT_145453 Exosome [BR:lgi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LOTGIDRAFT_145453 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  20234961 NCBI-ProteinID:  XP_009056373 JGI:  145453 UniProt:  V4ACW4 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search KLPFQRLVREIAQNFKTGLRFQNSTAMALQEASEAYLVGLFEDTNLCAIHTKRVTIMPKD IQLARRIRGERA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt aaacttcccttccaacgattggtgagagaaatcgctcaaaacttcaagactggtcttcga ttccagaactcaactgccatggctctccaagaagccagtgaggcttatttggtcggtctt ttcgaagataccaacttgtgtgccatccacaccaagagagtgaccattatgcccaaggac attcaattggcccgaagaatccgaggcgaacgtgcttaa

DBGET integrated database retrieval system