Lottia gigantea (owl limpet): LOTGIDRAFT_148041 Help Entry LOTGIDRAFT_148041 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K11252   histone H2B Organism lgi  Lottia gigantea (owl limpet) Brite KEGG Orthology (KO) [BR:lgi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lgi03036]     LOTGIDRAFT_148041   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgi04147]     LOTGIDRAFT_148041 Chromosome and associated proteins [BR:lgi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     LOTGIDRAFT_148041 Exosome [BR:lgi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LOTGIDRAFT_148041 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  20235330 NCBI-ProteinID:  XP_009061371 JGI:  148041 UniProt:  V3ZUA9 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MPPKVSAKGAKKAGKAKAARSGDKKKKRRRKESYSIYIYKVLKQVHPDTGVSSKAMSIMN SFVNDIFERIA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgccgccaaaggtttctgccaaaggggctaagaaagccggaaaagcaaaggccgcacgt agcggagacaagaagaagaaacgacgacgaaaggagtcttacagcatctacatctacaaa gtgctgaaacaagtccaccccgacactggagtcagcagcaaagctatgtctatcatgaac agtttcgtcaacgacattttcgagagaatcgct

DBGET integrated database retrieval system