Lottia gigantea (owl limpet): LOTGIDRAFT_150531 Help Entry LOTGIDRAFT_150531 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism lgi  Lottia gigantea (owl limpet) Pathway lgi03060   Protein export lgi04141   Protein processing in endoplasmic reticulum lgi04145   Phagosome Brite KEGG Orthology (KO) [BR:lgi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     LOTGIDRAFT_150531    04141 Protein processing in endoplasmic reticulum     LOTGIDRAFT_150531  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     LOTGIDRAFT_150531  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgi04131]     LOTGIDRAFT_150531   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:lgi02044]     LOTGIDRAFT_150531 Membrane trafficking [BR:lgi04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     LOTGIDRAFT_150531 Secretion system [BR:lgi02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    LOTGIDRAFT_150531 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Pho88 Motif Other DBs NCBI-GeneID:  20235515 NCBI-ProteinID:  XP_009059142 JGI:  150531 UniProt:  V4A4Y8 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search MDQVMQVVEPAKQFVKDSIRLVNRCTKPDRKEFQKIAMATAIGFCIMGFIGFFVKLIHIP INNIIVGS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggatcaggttatgcaagtagttgaacctgccaaacagttcgtaaaagactcgattcgt ttagtcaacagatgtacaaaaccagataggaaagaatttcagaaaattgctatggccaca gctattggattctgtatcatgggctttattggtttctttgttaaacttatccacattcca atcaataacattattgtaggatcctaa

DBGET integrated database retrieval system