Lottia gigantea (owl limpet): LOTGIDRAFT_156627 Help Entry LOTGIDRAFT_156627 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K11251   histone H2A Organism lgi  Lottia gigantea (owl limpet) Pathway lgi03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:lgi00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     LOTGIDRAFT_156627  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lgi03036]     LOTGIDRAFT_156627   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgi04147]     LOTGIDRAFT_156627 Chromosome and associated proteins [BR:lgi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     LOTGIDRAFT_156627 Exosome [BR:lgi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LOTGIDRAFT_156627 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  20237051 NCBI-ProteinID:  XP_009045506 JGI:  156627 UniProt:  V4AIS9 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRH LQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGSQKAA NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtttccagttggtcgtattcacagacatttgaagaacagaaccacaagccatgggcga gttggagcgaccgcagcagtgtacagtgctgcaattttggaatatcttactgctgaggtg cttgagttggcaggtaatgccagtaaagatttaaaagtaaaacgtatcacaccaagacat ttacaattagctatcagaggagatgaggaattagattctcttatcaaagcaacaattgct ggcggtggtgttatacctcatattcacaagtctctcattggaaagaagggttctcaaaaa gcagcataa

DBGET integrated database retrieval system