Lottia gigantea (owl limpet): LOTGIDRAFT_166689 Help Entry LOTGIDRAFT_166689 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism lgi  Lottia gigantea (owl limpet) Pathway lgi03020   RNA polymerase lgi03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:lgi00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     LOTGIDRAFT_166689   09124 Replication and repair    03420 Nucleotide excision repair     LOTGIDRAFT_166689  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:lgi03021]     LOTGIDRAFT_166689    03400 DNA repair and recombination proteins [BR:lgi03400]     LOTGIDRAFT_166689 Transcription machinery [BR:lgi03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      LOTGIDRAFT_166689   RNA polymerase III system    RNA polymerase III      LOTGIDRAFT_166689   RNA polymerase I system    RNA polymerase I      LOTGIDRAFT_166689 DNA repair and recombination proteins [BR:lgi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       LOTGIDRAFT_166689 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  20240419 NCBI-ProteinID:  XP_009062353 JGI:  166689 UniProt:  V4A0Z9 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MIIPIRCFTCGKVIGNKWEAYIGLLQVEYTEGDALDALGLKRYCCRRMLLSHVDLIEKLL NYAPLEK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgattatccctattcgatgttttacctgtggtaaagttattggtaataaatgggaggcg tatattggactattacaagttgaatatactgaaggggatgcgttagatgctttaggttta aagagatattgttgtcgaagaatgttactgtctcacgttgatctgattgaaaaactcttg aattacgctccacttgaaaaatag

DBGET integrated database retrieval system