Lottia gigantea (owl limpet): LOTGIDRAFT_180756 Help Entry LOTGIDRAFT_180756 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K11252   histone H2B Organism lgi  Lottia gigantea (owl limpet) Brite KEGG Orthology (KO) [BR:lgi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lgi03036]     LOTGIDRAFT_180756   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lgi04147]     LOTGIDRAFT_180756 Chromosome and associated proteins [BR:lgi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     LOTGIDRAFT_180756 Exosome [BR:lgi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LOTGIDRAFT_180756 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID DUF1931 Motif Other DBs NCBI-GeneID:  20244415 NCBI-ProteinID:  XP_009065731 JGI:  180756 UniProt:  V4AAU3 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgtctatcatgaacagtttcgtcaacgacattttcgagagaatcgctgccgaagcttca agactcgctcactacaacaaaagatcgaccatcaccagcagggaaatccaaactgccgtt cgacttctgttacccggtgagctcgccaagcacgccgtttccgaaggaacaaaggccgtc accaaatacaccagctccaaataa

DBGET integrated database retrieval system