Lottia gigantea (owl limpet): LOTGIDRAFT_182626 Help Entry LOTGIDRAFT_182626 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K08341   GABA(A) receptor-associated protein Organism lgi  Lottia gigantea (owl limpet) Pathway lgi04068   FoxO signaling pathway lgi04136   Autophagy - other lgi04137   Mitophagy - animal lgi04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:lgi00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     LOTGIDRAFT_182626  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     LOTGIDRAFT_182626    04136 Autophagy - other     LOTGIDRAFT_182626    04137 Mitophagy - animal     LOTGIDRAFT_182626  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgi04131]     LOTGIDRAFT_182626    04121 Ubiquitin system [BR:lgi04121]     LOTGIDRAFT_182626    03029 Mitochondrial biogenesis [BR:lgi03029]     LOTGIDRAFT_182626 Membrane trafficking [BR:lgi04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     LOTGIDRAFT_182626 Ubiquitin system [BR:lgi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    LOTGIDRAFT_182626 Mitochondrial biogenesis [BR:lgi03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     LOTGIDRAFT_182626 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  20244504 NCBI-ProteinID:  XP_009058046 JGI:  182626 UniProt:  V4ADG8 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MKWQYKEEHPFEKRRAEGEKIRKKYPDRVPVIVEKAPKARVGDLDKKKYLVPSDLTVGQF YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGA NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaagtggcaatacaaagaagagcacccttttgaaaagcgaagggcagagggtgagaag atcagaaagaagtatccagatagggtaccagttattgtagaaaaagcacctaaagcacga gttggagacttggataagaaaaaatatttagttccctcagatttgactgttggtcaattt tattttctaattagaaaaagaattcatttaagaccagaagatgctttgtttttctttgta aacaatgtgattccccctaccagtgcaacaatgggtcaactttaccaggaacatcatgaa gaagactttttcttatatattgcatacagtgatgaaagtgtttatggtgcgtag

DBGET integrated database retrieval system