Lottia gigantea (owl limpet): LOTGIDRAFT_206820 Help Entry LOTGIDRAFT_206820 CDS       T03273                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism lgi  Lottia gigantea (owl limpet) Pathway lgi04814   Motor proteins Brite KEGG Orthology (KO) [BR:lgi00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     LOTGIDRAFT_206820  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lgi03037]     LOTGIDRAFT_206820    04812 Cytoskeleton proteins [BR:lgi04812]     LOTGIDRAFT_206820 Cilium and associated proteins [BR:lgi03037]  Motile cilia and associated proteins   Dynein arm    LOTGIDRAFT_206820 Cytoskeleton proteins [BR:lgi04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      LOTGIDRAFT_206820 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Imm48 SGTA_dimer Motif Other DBs NCBI-GeneID:  20245940 NCBI-ProteinID:  XP_009059708 JGI:  206820 UniProt:  V4A8N2 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQADSIECATQALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLYKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgatagaaaagctgttattaaaaatgccgacatgtcggaagatatgcaagccgac tctatcgaatgcgccacccaagccctggagaaatttaacattgaaaaagacattgctgcc tacatcaagaaagaattcgataaaaaatacaacccaacatggcactgtattgtcggcaga aactttggaagttacgtgacccacgaaaccaaacatttcatatacttctatttgggtcaa gtcgccattttgttgtataagtctggttag

DBGET integrated database retrieval system