KEGG   Lysobacter gummosus: LG3211_0225
Entry
LG3211_0225       CDS       T04163                                 
Name
(GenBank) putative ATP synthase yscN
  KO
K03224  ATP synthase in type III secretion protein N [EC:7.4.2.8]
Organism
lgu  Lysobacter gummosus
Pathway
lgu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lgu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LG3211_0225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lgu02044]
    LG3211_0225
Enzymes [BR:lgu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     LG3211_0225
Secretion system [BR:lgu02044]
 Type III secretion system
  Type III secretion core apparatus
   LG3211_0225
SSDB
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ATP-synt_ab_N DUF87
Other DBs
NCBI-ProteinID: ALN89215
UniProt: A0ABY3XEN5
LinkDB
Position
239605..240957
AA seq 450 aa
MSNLQRTILQPVPAPVQQDPLLTALARVPSVVRVGKVAEAYGTMIRATGLKAMIGELCEL
RNPRDRSFRLMAEVVGVSRQHTLLTPLGALDGLSHDTEVIATGRQASVRAGDGLLGRILD
ANGDAIDGRGSFGPTVQIPIYAASPNPLARTLIDRPFATGVRAIDTVMTAGVGQRLGIFA
VAGGGKSTLLGMLARGGDADVNVIALVGERGREVNEFIHDNLGEEGLKKSIIVVATSDRP
ALERSRAAWVATAISEYFRDRGKRVMLLVDSVTRFARALRDVGLAIGEPPARRGFPPSVF
SAMPRLFERAGNNDKGSITAFYTVLMEGEDGDDPVAEEVRSILDGHIVLSRKLAAAYHYP
AIDVLTSLSRTMPRVADEGHQRAAGQLRKYLAKHQDIELLLQLGEYKRGSDAEADIAIEK
IEPIRKLLKQSANDLADYKQSIDALRRLFG
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgagcaacctgcagcgcaccatcctgcaaccggtgcccgcgccggtgcagcaagatccg
ctgctgaccgcgctggcgcgcgtgcccagcgtggtgcgcgtgggcaaggtcgcggaagcc
tacggcacgatgatccgcgccaccggcctgaaggcgatgatcggcgagctgtgcgagctg
cgtaacccgcgcgaccgaagcttccgcctgatggcggaagtggtcggcgtctcgcgccag
cacaccctgctgacgccgctgggcgcgctcgacggcctgtcgcacgacaccgaagtcatc
gccaccggccgccaggcctcggtgcgcgccggcgacggcctgctcgggcgcattctcgac
gccaacggcgatgccatcgacggccgtggttcgttcggcccgaccgtgcagattccgatc
tacgccgcctcgcccaatccgctggcgcgcacgctcatcgaccggccgttcgcgaccggc
gtgcgcgcgatcgacacggtgatgaccgccggcgtcggccagcgcctgggcatcttcgcc
gtcgccggcggcggcaagagcaccttgctcggcatgctcgcgcgcggcggcgacgccgac
gtcaacgtgatcgccctggtcggcgagcgcggccgcgaagtcaacgaattcatccacgac
aatctgggcgaagaaggcctgaagaaatcgatcatcgtggtcgccacctccgaccggccc
gcgctcgaacgcagccgcgcggcctgggtggccacggccatctccgagtatttccgcgat
cgcggcaagcgggtgatgctgctggtggactcggtgacgcgattcgcccgcgccttgcgc
gacgtcggcctggcgatcggcgaaccgccggcgcggcgcggctttccgccgtcggtgttc
agcgccatgccgcgcctgttcgagcgcgccggcaacaacgacaagggcagcatcaccgcg
ttctacacggtgctgatggaaggcgaggacggcgacgatccggtcgccgaggaagtgcgc
tcgattctcgacggccacatcgtgctgtcgcgcaagctcgccgccgcgtatcactacccg
gccatcgacgtgctgaccagcctgagccggaccatgccgcgggtggccgacgaaggccat
cagcgcgccgccggccagctgcgcaagtacctggccaagcaccaggacatcgagctgctg
ctgcagctgggcgaatacaagcgcggcagcgacgccgaggccgatatcgccatcgagaag
atcgagccgatccgcaaattgctcaagcagtcggccaacgatctggccgactacaaacaa
tccatcgacgcgctgcgcaggttgttcggatga

DBGET integrated database retrieval system