Lysobacter gummosus: LG3211_0873 Help Entry LG3211_0873       CDS       T04163                                  Name (GenBank) ACT domain protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism lgu  Lysobacter gummosus Pathway lgu00290   Valine, leucine and isoleucine biosynthesis lgu00650   Butanoate metabolism lgu00660   C5-Branched dibasic acid metabolism lgu00770   Pantothenate and CoA biosynthesis lgu01100   Metabolic pathways lgu01110   Biosynthesis of secondary metabolites lgu01210   2-Oxocarboxylic acid metabolism lgu01230   Biosynthesis of amino acids Module lgu_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine lgu_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:lgu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     LG3211_0873    00660 C5-Branched dibasic acid metabolism     LG3211_0873   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     LG3211_0873   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     LG3211_0873 Enzymes [BR:lgu01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      LG3211_0873 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 DUF3710 Motif Other DBs NCBI-ProteinID:  ALN89855 LinkDB All DBs Position complement(961885..962121) Genome browser AA seq 78 aa AA seqDB search MRYQLELTLRQAEGALARVLGAAERRGFRPLSVDGEAQPDGDRWHLRMTVEGDRADTALQ SQLAKLYDCLAVEVSPCS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcgataccagcttgaactgaccctgcgccaggccgaaggcgcgctggcacgcgtattg ggcgccgccgaacgccgcggtttccgtccgctctccgtggacggcgaagcgcaacccgac ggcgatcgctggcatctgcgcatgacggtggaaggcgatcgcgccgacaccgctttgcag agccagctcgccaagctttacgactgtcttgccgttgaggtttctccatgcagctga

DBGET integrated database retrieval system