Lysobacter gummosus: LG3211_1738 Help Entry LG3211_1738       CDS       T04163                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lgu  Lysobacter gummosus Pathway lgu01100   Metabolic pathways lgu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lgu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LG3211_1738 (acpP)    00074 Mycolic acid biosynthesis     LG3211_1738 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LG3211_1738 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  ALN90712 UniProt:  A0ABY3XHU2 LinkDB All DBs Position 1897820..1898059 Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGVKEEEVTNNASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagaacgcgtcaagaagatcgtggtcgaacaactcggcgtcaaggaa gaagaagtcaccaacaacgcttcgttcgtcgacgacctcggcgcagattcgctcgacacc gtcgagctggtgatggcactcgaagaagagttcgagtgcgagattccggatgaagaagcc gagaagatcacctcggtgcagcaggcgatcgattacgtcaaggcgcacgtcaagtcgtaa

DBGET integrated database retrieval system