Legionella hackeliae: LHA_1810 Help Entry LHA_1810          CDS       T03809                                  Symbol fis Name (GenBank) DNA-binding protein fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism lha  Legionella hackeliae Brite KEGG Orthology (KO) [BR:lha00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:lha03000]     LHA_1810 (fis)    03036 Chromosome and associated proteins [BR:lha03036]     LHA_1810 (fis)    03400 DNA repair and recombination proteins [BR:lha03400]     LHA_1810 (fis) Transcription factors [BR:lha03000]  Prokaryotic type   Helix-turn-helix    Other families     LHA_1810 (fis) Chromosome and associated proteins [BR:lha03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     LHA_1810 (fis) DNA repair and recombination proteins [BR:lha03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       LHA_1810 (fis) SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_29 HTH_28 Sigma70_r4 HTH_23 Sigma70_r4_2 Phage_NinH HTH_17 HTH_50 HTH_30 HTH_3 HTH_24 NUMOD1 Motif Other DBs NCBI-ProteinID:  CEK10843 UniProt:  A0A0A8UQ03 LinkDB All DBs Position I:1870049..1870345 Genome browser AA seq 98 aa AA seqDB search MNVIETQASSQSVKQDQGLQDLVYSLVTRFLAENKNKPIDDLYDMILSEVEPPLLQAVME KRRGNQLQAARMLGISRGTIRKKLQRYFGTKYFRLTDE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaatgtcattgaaacacaagcctcttctcaaagcgtgaaacaagatcaaggtctccaa gatctagtttatagcttagtaacccgttttcttgctgagaataaaaataaacctattgat gatctctatgacatgattctttcagaagttgagccacctcttttacaagctgttatggaa aaacgacgtggaaaccaactgcaagcagcaagaatgcttggaatcagccgcggcactatc aggaaaaaattacaacgttactttggtacaaagtatttccgtttaacggacgagtaa

DBGET integrated database retrieval system