Lactobacillus helveticus DPC 4571: lhv_1931 Help Entry lhv_1931          CDS       T00625                                  Name (GenBank) Acyl carrier   KO K02078   acyl carrier protein Organism lhe  Lactobacillus helveticus DPC 4571 Pathway lhe01100   Metabolic pathways lhe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lhe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     lhv_1931    00074 Mycolic acid biosynthesis     lhv_1931   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     lhv_1931 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABX27769 UniProt:  A8YXR9 LinkDB All DBs Position complement(1902538..1902780) Genome browser AA seq 80 aa AA seqDB search MTKEEVFNKIKDIIVDQLDVDADKVKENTNFKNDLDLDSLDIFEVIDKIEDLYDIEIDTD ESMETVGELVDYVLKQKTDK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgactaaagaagaagtatttaacaagatcaaggacattatcgtagaccaattggacgta gacgctgacaaggttaaagaaaacaccaatttcaagaacgacttggatttagacagtttg gacatctttgaagtgattgacaagatcgaagacctttacgatatcgaaatcgatactgat gaaagtatggaaactgtcggtgaattagttgattacgttttgaagcaaaaaactgacaag tag

DBGET integrated database retrieval system