Leptotrichia hofstadii: JCM16775_0955 Help Entry JCM16775_0955     CDS       T06149                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lhf  Leptotrichia hofstadii Pathway lhf01100   Metabolic pathways lhf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lhf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JCM16775_0955    00074 Mycolic acid biosynthesis     JCM16775_0955   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JCM16775_0955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BBM38247 UniProt:  A0A510JG78 LinkDB All DBs Position 985001..985225 Genome browser AA seq 74 aa AA seqDB search MLDKIKSIVVDQLGVDEDQVTEDASFVDDLGADSLDTVELIMAFEEEFDIEIPDEDAQKI KTVKDVIEYIESKQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgctagataaaattaaatcaatagtagtagatcaattaggagtagacgaagatcaagta actgaagatgcatcttttgttgatgatttaggagcagattcgttagatacagttgaatta atcatggcttttgaagaagaatttgacattgaaattcctgatgaagatgcacaaaaaatt aaaacagttaaagatgtaattgaatacatcgaatctaaacaatag

DBGET integrated database retrieval system