KEGG   Leptotrichia hofstadii: JCM16775_0958
Entry
JCM16775_0958     CDS       T06149                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
lhf  Leptotrichia hofstadii
Pathway
lhf00770  Pantothenate and CoA biosynthesis
lhf01100  Metabolic pathways
lhf01240  Biosynthesis of cofactors
Module
lhf_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lhf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    JCM16775_0958
Enzymes [BR:lhf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     JCM16775_0958
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-ProteinID: BBM38250
UniProt: A0A510JG56
LinkDB
Position
987998..988501
AA seq 167 aa
MEKVALYPGSFDPITKGHIDIIKRSSHLFDKLIIGIFKNSTKSKAWFSDEEKVEMIEEIL
KKEDVDAEIKIFNGLLVDFMYEEKVNILIRGLRALSDYEYELQFTLTNKTLSKSEFETVF
LTASREYLYLSSSLVKEVALNKGDLHFFVTENVEKRLIKKVEELQKD
NT seq 504 nt   +upstreamnt  +downstreamnt
atggaaaaagtggcgttatatccagggagttttgatccaataacgaagggacatattgat
attataaaacgttcttcacatttatttgataagttaataataggaatttttaaaaattct
acaaaatcaaaagcctggttttcagatgaagaaaaagttgagatgatagaagaaatcttg
aaaaaagaagatgttgatgctgaaataaagatttttaacggattgctagttgattttatg
tatgaagaaaaggtaaatattttaataagagggcttcgtgctttatcggattatgaatac
gagttacaatttacgcttacaaataaaacactttcaaaaagtgaatttgaaacagtgttt
ttaacggcttcaagggaatatttatacttgagttcaagtcttgtgaaggaagtcgcatta
aataaaggtgatttacatttttttgttacagaaaatgtagaaaagcgtttaattaaaaaa
gttgaagaattacaaaaagactaa

DBGET integrated database retrieval system