Lentilactobacillus hilgardii: G8J22_01425 Help Entry G8J22_01425       CDS       T06851                                  Name (GenBank) putative tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism lhil  Lentilactobacillus hilgardii Pathway lhil00362   Benzoate degradation lhil00622   Xylene degradation lhil01100   Metabolic pathways lhil01120   Microbial metabolism in diverse environments lhil01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:lhil00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     G8J22_01425    00622 Xylene degradation     G8J22_01425    00621 Dioxin degradation     G8J22_01425 Enzymes [BR:lhil01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      G8J22_01425 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  QIR09446 LinkDB All DBs Position 1415910..1416098 Genome browser AA seq 62 aa AA seqDB search MPIVNIQLIAGRSQDQLKALVADVTAAVVKDTGAPAEHVHVILDEMQKNRYSVGGVLKSD EK NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgccaatcgtaaatattcaacttattgccggccgttcacaagatcaattgaaagcatta gtcgcagacgttactgcagctgttgttaaggataccggtgcaccggcagaacatgtccat gtgattttggatgaaatgcaaaagaatcgttacagtgtaggcggcgttttaaaaagcgac gaaaaataa

DBGET integrated database retrieval system