Lactobacillus helveticus H10: LBHH_0386 Help Entry LBHH_0386         CDS       T01959                                  Symbol groES Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism lhl  Lactobacillus helveticus H10 Brite KEGG Orthology (KO) [BR:lhl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lhl03110]     LBHH_0386 (groES)    03029 Mitochondrial biogenesis [BR:lhl03029]     LBHH_0386 (groES) Chaperones and folding catalysts [BR:lhl03110]  Heat shock proteins   HSP10    LBHH_0386 (groES) Mitochondrial biogenesis [BR:lhl03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     LBHH_0386 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Trypsin Motif Other DBs NCBI-ProteinID:  ADX69615 LinkDB All DBs Position 392894..393178 Genome browser AA seq 94 aa AA seqDB search MLQPIGDRVIVKVKDEEEKTVGGIVLASNAKKKPTEGEVVAVGEGAYASNGEKIPMSVKK GDVVLYDRYSGTNVEYEGEKYLVLHEKDILAIAK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgttacaaccaatcggtgatcgtgtgatcgtaaaagttaaagatgaagaagaaaagact gttggtggtattgttttagcatctaacgctaagaagaagccaactgaaggtgaagttgta gccgtaggtgaaggtgcttacgcatcaaacggtgaaaagattcctatgtcagttaagaaa ggcgacgtagttctctacgatagatactctggcaccaacgttgaatacgaaggtgaaaag tacttagtccttcatgaaaaagacattttagcaattgcaaaataa

DBGET integrated database retrieval system