Lacticaseibacillus huelsenbergensis: LHUE1_002650 Help Entry LHUE1_002650      CDS       T09416                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lhn  Lacticaseibacillus huelsenbergensis Pathway lhn01100   Metabolic pathways lhn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lhn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LHUE1_002650 (acpP)    00074 Mycolic acid biosynthesis     LHUE1_002650 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LHUE1_002650 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 TerB HLH WHD_SNRNP200 Motif Other DBs NCBI-ProteinID:  WFB39092 UniProt:  A0ABY8DRC8 LinkDB All DBs Position complement(2867844..2868086) Genome browser AA seq 80 aa AA seqDB search MSEDEIYQKIAGLIQDHFQLSPDKISPSLNFKQDLDADSIDIVEFVLELEDAFGAEIPDD DAEKIQTVQDAVDYIKAHQK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagtgaagacgaaatttatcaaaagatcgcaggcttgattcaggaccattttcagtta agtcctgacaaaatcagtccaagcttgaatttcaagcaagaccttgatgcagattcgatt gatattgtcgaatttgttttggaactcgaagatgcattcggcgcggaaattccagatgac gatgcggaaaagatccaaacagttcaagatgcggttgattacatcaaagcacatcaaaaa tag

DBGET integrated database retrieval system