Lactobacillus helveticus R0052: R0052_11025 Help Entry R0052_11025       CDS       T02217                                  Name (GenBank) Acyl carrier   KO K02078   acyl carrier protein Organism lhr  Lactobacillus helveticus R0052 Pathway lhr01100   Metabolic pathways lhr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lhr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R0052_11025    00074 Mycolic acid biosynthesis     R0052_11025   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R0052_11025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AFR22897 LinkDB All DBs Position complement(1951246..1951488) Genome browser AA seq 80 aa AA seqDB search MTKEEVFNKIKDIIVDQLDVDADKVKENTNFKNDLDLDSLDIFEVIDKIEDLYDIEIDTD EGMETVGELVDYVLKQKTDK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgactaaagaagaagtatttaacaagatcaaggacattatcgtagaccaattggacgta gacgctgacaaggttaaagaaaacaccaatttcaagaacgacttggatttagacagtttg gacatctttgaagtgattgacaagatcgaagacctttacgatatcgaaatcgatactgat gaaggtatggaaactgtcggtgaattagttgattacgttttgaagcaaaaaactgacaag tag

DBGET integrated database retrieval system