Linepithema humile (Argentine ant): 105671556 Help Entry 105671556         CDS       T04898                                  Symbol Rab7 Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism lhu  Linepithema humile (Argentine ant) Pathway lhu04137   Mitophagy - animal lhu04140   Autophagy - animal lhu04144   Endocytosis lhu04145   Phagosome lhu04148   Efferocytosis Brite KEGG Orthology (KO) [BR:lhu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105671556 (Rab7)    04145 Phagosome     105671556 (Rab7)    04140 Autophagy - animal     105671556 (Rab7)    04137 Mitophagy - animal     105671556 (Rab7)    04148 Efferocytosis     105671556 (Rab7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lhu04131]     105671556 (Rab7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lhu04147]     105671556 (Rab7)    04031 GTP-binding proteins [BR:lhu04031]     105671556 (Rab7) Membrane trafficking [BR:lhu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105671556 (Rab7) Exosome [BR:lhu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105671556 (Rab7)   Exosomal proteins of other body fluids (saliva and urine)    105671556 (Rab7)   Exosomal proteins of colorectal cancer cells    105671556 (Rab7)   Exosomal proteins of bladder cancer cells    105671556 (Rab7) GTP-binding proteins [BR:lhu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105671556 (Rab7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin AAA_16 PduV-EutP AAA_7 AAA_22 NTPase_1 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  105671556 NCBI-ProteinID:  XP_012221244 LinkDB All DBs Position 3:20227855..20233728 Genome browser AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVSAPTSFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLESRAVSSKRAQQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRSNGRGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcatcccgcaagaaagtactgctgaaggttataatccttggagattctggagtcggt aaaacatctttgatgaatcagtatgtcaacaagaagtttagtaatcaatataaagcaacg ataggagcagatttcttgaccaaggaagtgatggtagaggacagaatagttactatgcag atctgggataccgctggacaagaaaggtttcagtccttaggagtggctttttacagaggt gcagactgttgcgtgctcgtatttgatgtatccgctccgactagcttcaaatctttagat tcatggagagatgaatttctaattcaagcttcgcctcgagatccagacaactttccgttt gtcgtgctcggaaataaagtagatctcgagtcaagagcagtgtcgagcaagagagcacaa cagtggtgtcaatcaaagaataatattccatacttcgaaactagtgcaaaagaggctatc aatgtcgagcaagctttccaaacgatagctaagaatgctttagctcaagaaagtgaagtc gaactttacaatgaattcccggatcaaatcaaattgaccaacgaccaaagaagcaacggc agaggtgattcatgcgcttgctag

DBGET integrated database retrieval system