KEGG   Linepithema humile (Argentine ant): 105675509
Entry
105675509         CDS       T04898                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
lhu  Linepithema humile (Argentine ant)
Pathway
lhu00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105675509
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lhu00199]
    105675509
Enzymes [BR:lhu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105675509
Cytochrome P450 [BR:lhu00199]
 Cytochrome P450, animal type
  CYP306 family
   105675509
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105675509
NCBI-ProteinID: XP_012228131
LinkDB
Position
Unknown
AA seq 489 aa
MISLTYIILGVSFILFAYVFRKNCKTLRLPPGPTGIPLLGYLPWLDPQRPHESLTNLARK
YGPICGLRLGSVYTILLSDPQLVRQAFAKDAFAGRAPLYLTHGIMQGYGLICAEGDRWKT
QRRFVAEFLKHLGMKSSGFMRDKLEERILVAVNECILKLRNRSTENGIDPLETLHHCFGN
VINDLVFGKVYEEDDKVWKWLRHLQEEGVKHIGVAGPLNFLPFLRFLPRFGKLIESLIDG
KQKTHQIYQTIIDEYRVRREKTDNFLAVFDDVMTANTDNPGHFTQPQFYHMLADLFGAGV
DTTLTSFRWFLLFMAVYPDEQKKVQDEMNELLGQKLPSLEDRLILIRLEAAIMETQRLRS
VVPIGIPHGTIENTQVGGYDVPKGTMVIPLQYAIHTDSSYWQDPLSFRPERFITDEGALA
KPKAFLPFQTGKRMCVGDELARMMLFLFAARILHSFAISTPSGAHIDLEGECGITLVPKP
HRLVFTPRE
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgatatcccttacttatattatcctcggcgtatctttcatactttttgcttatgtcttt
cgcaaaaattgtaaaacacttcgacttccgccgggaccaaccggtataccgctactcgga
tatttaccatggctggatcctcaacgtcctcacgagtcgctaacgaatctggcgaggaag
tacggcccgatttgtggactacgattgggctcggtatatacgattttattgtcggatcct
cagctggtaagacaggcctttgccaaagatgcgtttgccggcagggctccgctttactta
acacatggaataatgcaaggatacggtttaatttgcgccgagggtgaccgttggaagact
caaagaagattcgtagccgaattcttgaagcatcttggtatgaagtcatctggctttatg
agagataaattggaggagcgaattctcgtggcggtgaacgagtgcatattgaaattaaga
aatcgctctacggagaacggtattgatccattggagacgcttcatcactgcttcggtaat
gtaatcaacgacctcgtgtttggtaaagtttacgaggaggatgacaaggtgtggaaatgg
ttgagacatttacaagaggaaggagtcaagcacattggagttgcagggccactcaacttt
ttgccatttctcagatttttaccacgatttggcaagttaatagaatcacttatcgacggc
aagcagaaaacgcatcagatatatcagacgattatcgatgaatatcgtgttcgtcgtgaa
aagacggataactttcttgcggttttcgacgacgtaatgacggccaatacggacaatcct
ggacatttcacacagccgcaattttatcatatgttagccgatcttttcggagcaggtgtc
gataccactcttacaagtttccgctggttcctactcttcatggcggtatatccggacgaa
cagaaaaaagttcaggatgagatgaacgaactcttgggacaaaagttacccagtttggag
gacaggctgattttaattcgactggaagcagctatcatggagacacaaaggttgcgaagc
gttgtgccgatcggtattccacacggtacaatagagaacacacaagtcggaggttatgat
gttccaaaagggaccatggtcatcccgctacagtatgctattcatacagactcatcttac
tggcaagatcctctttcttttaggcccgaaagattcatcactgatgaaggggctcttgct
aagcccaaggcttttttaccttttcaaacaggcaaacgaatgtgcgtcggcgatgaactg
gccagaatgatgttatttttgttcgctgcgagaattcttcattcatttgccatctctacg
ccatccggcgcgcacatcgatctggagggcgaatgcggaattactctggttccgaaaccg
catcggttggtttttacaccacgagaataa

DBGET integrated database retrieval system