Liquorilactobacillus hordei: BSQ49_07595 Help Entry BSQ49_07595       CDS       T06631                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lhw  Liquorilactobacillus hordei Pathway lhw01100   Metabolic pathways lhw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lhw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSQ49_07595    00074 Mycolic acid biosynthesis     BSQ49_07595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSQ49_07595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB Nup192 HEPN_Cthe2314 Motif Other DBs NCBI-ProteinID:  AUJ30078 UniProt:  A0A3Q8CM62 LinkDB All DBs Position complement(1556208..1556450) Genome browser AA seq 80 aa AA seqDB search MTEKEIYDKIVKIINERFEIEEGKVTPELNFSTDLNADSIDIVEFVLELEDTFSAEIPDE DAEKLFTVADAVKYISDHQG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacagaaaaagaaatttatgacaaaattgtgaaaattattaatgaacgttttgaaatt gaagaaggtaaagtaactcctgaattgaatttttcaacggatttgaacgctgattcaata gatattgttgaatttgtactagaactagaagatacgttttcagctgagatacctgatgaa gatgcagaaaaattattcactgttgcagatgcagttaaatacatttctgatcaccaagga tag

DBGET integrated database retrieval system