Lysobacter helvus: LYSHEL_12090 Help Entry LYSHEL_12090      CDS       T07483                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism lhx  Lysobacter helvus Pathway lhx03060   Protein export lhx03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:lhx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     LYSHEL_12090  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     LYSHEL_12090  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:lhx02044]     LYSHEL_12090 Secretion system [BR:lhx02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    LYSHEL_12090 SSDB OrthologParalogGFIT Motif Pfam:  TatA_B_E DUF2852 Ni_hydr_CYTB DUF4834 Motif Other DBs NCBI-ProteinID:  BCT95338 UniProt:  A0ABM7QCS6 LinkDB All DBs Position 1245761..1246015 Genome browser AA seq 84 aa AA seqDB search MGGFSIWHWLIVLVIVVLVFGTKRLGSVGKDLGEAVKGFKKGMDDSDSKPSARLPDANNT RDEIDQRERERREQEQRDRNEPPR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgggtggtttcagcatctggcattggctgatcgtgctggtcatcgtggtgctggtgttc ggcaccaagcgcctcggcagcgtcggcaaggatctcggcgaagcggtgaaaggcttcaag aagggcatggacgacagcgacagcaagccgtccgcgcgcctgcccgacgccaacaacacg cgcgacgagatcgaccagcgcgagcgcgagcgccgcgagcaggaacaacgcgaccgcaac gagccgccgcgctaa

DBGET integrated database retrieval system