Leptospira interrogans serovar Lai IPAV: LIF_A1398 Help Entry LIF_A1398         CDS       T01983                                  Symbol panD Name (GenBank) aspartate alpha-decarboxylase   KO K01579   aspartate 1-decarboxylase [EC:4.1.1.11] Organism lie  Leptospira interrogans serovar Lai IPAV Pathway lie00410   beta-Alanine metabolism lie00770   Pantothenate and CoA biosynthesis lie01100   Metabolic pathways lie01110   Biosynthesis of secondary metabolites lie01240   Biosynthesis of cofactors Module lie_M00119   Pantothenate biosynthesis, valine/L-aspartate => pantothenate Brite KEGG Orthology (KO) [BR:lie00001]  09100 Metabolism   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     LIF_A1398 (panD)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     LIF_A1398 (panD) Enzymes [BR:lie01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.1  Carboxy-lyases     4.1.1.11  aspartate 1-decarboxylase      LIF_A1398 (panD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asp_decarbox Motif Other DBs NCBI-ProteinID:  AER02198 LinkDB All DBs Position 1:complement(1717128..1717463) Genome browser AA seq 111 aa AA seqDB search MKGKIHRATVTDADLNYEGSLTVDMDLVDAAGMRVYEKVSVVNVNNGARFETYIIEGKRG SGEICLNGAAARLGMKGDKIIIITYAQVEEQELASDYTPKVVHVDEKNRKR NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgaaaggtaaaatccaccgggccacggtaacagacgcggatttaaactatgaaggaagt ctgaccgtggatatggatcttgtagatgctgcgggaatgcgagtatacgagaaggtttcc gtagtgaacgtaaacaatggagcccgttttgaaacctatatcatagagggaaaaagaggt tccggagaaatctgtttgaatggggcagccgcaagactaggaatgaagggtgataagatc atcatcatcacttatgctcaagtagaagaacaagaacttgcttcagactacactcctaaa gtagttcacgttgacgaaaaaaatcgaaaacgttaa

DBGET integrated database retrieval system