Leptospira interrogans serovar Lai IPAV: LIF_B066 Help Entry LIF_B066          CDS       T01983                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lie  Leptospira interrogans serovar Lai IPAV Pathway lie01100   Metabolic pathways lie01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lie00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LIF_B066 (acpP)    00074 Mycolic acid biosynthesis     LIF_B066 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LIF_B066 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AER04309 LinkDB All DBs Position 2:74006..74239 Genome browser AA seq 77 aa AA seqDB search MADFEKVKSIIVEQLGVDESEVTPEAHFIDDLGADSLDTVELVMALEEEFGIEISDEDAE KIQTVGDVTKFIDNLKS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagactttgaaaaggttaaatctattatcgtagaacaacttggcgtggatgaatct gaagttacacctgaggctcacttcatcgatgacctcggtgcagactctttggatacggtt gaattagtaatggctctcgaagaagaattcggaatcgaaatctccgacgaagatgctgaa aaaattcaaactgtcggggatgtaactaagttcatcgacaacctcaagtcctaa

DBGET integrated database retrieval system