Limnohabitans sp. 63ED37-2: L63ED372_00818 Help Entry L63ED372_00818    CDS       T04121                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism lih  Limnohabitans sp. 63ED37-2 Pathway lih01100   Metabolic pathways lih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lih00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L63ED372_00818 (acpP)    00074 Mycolic acid biosynthesis     L63ED372_00818 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L63ED372_00818 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  ALK88040 LinkDB All DBs Position 851060..851296 Genome browser AA seq 78 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQAAIDYAQSKKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgccgaacaactcggcgttgaagag tcacaagtcaccaacgaaaaagcctttgtggccgatctgggtgccgactccctggacacg gtggaattggtgatggcactcgaagacgagtttggcatcgagattcctgacgaagacgca gaaaaaatcaccacggtgcaagctgcgattgactacgcccaaagcaagaaggcctga

DBGET integrated database retrieval system