Limnohabitans sp. 103DPR2: L103DPR2_01048 Help Entry L103DPR2_01048    CDS       T04120                                  Symbol grxC_2 Name (GenBank) Glutaredoxin-3   KO K03676   glutaredoxin 3 Organism lim  Limnohabitans sp. 103DPR2 Brite KEGG Orthology (KO) [BR:lim00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lim03110]     L103DPR2_01048 (grxC_2) Chaperones and folding catalysts [BR:lim03110]  Protein folding catalysts   Protein disulfide isomerase    L103DPR2_01048 (grxC_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_3 Thioredoxin_2 GST_N_3 GST_N Motif Other DBs NCBI-ProteinID:  ALK91452 UniProt:  A0A0P0MEE2 LinkDB All DBs Position 1057295..1057537 Genome browser AA seq 80 aa AA seqDB search MSLKIVVYSKSACPQCESAKMLLKTRSLAYEEIKIDDEAERMAFYEKCGPSVRQMPQVFI NDQRVGGLAGLQAALAQLSQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcctcaaaatcgttgtttattccaagtccgcgtgcccacaatgtgagtccgccaaa atgctcctcaaaacacgttctttggcgtacgaggaaatcaaaattgatgacgaagccgag cgaatggctttttatgaaaaatgcggcccatctgtccgtcagatgccccaagttttcatc aacgaccagcgcgtgggcgggctggcagggttgcaggcggccttggcgcaactcagccaa taa

DBGET integrated database retrieval system