Limnohabitans sp. 103DPR2: L103DPR2_02430 Help Entry L103DPR2_02430    CDS       T04120                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism lim  Limnohabitans sp. 103DPR2 Pathway lim01100   Metabolic pathways lim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L103DPR2_02430 (acpP)    00074 Mycolic acid biosynthesis     L103DPR2_02430 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L103DPR2_02430 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALK92812 UniProt:  A0A0P0MHR6 LinkDB All DBs Position complement(2512267..2512503) Genome browser AA seq 78 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTPEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVKAAIDYAQSKKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgctgaacaactcggcgttgaagag tcacaagtcacaccagagaaagcattcgttgctgacttgggcgcagactcactggacaca gtagagctggtaatggcgttagaagacgaatttggaattgaaattccagacgaagacgct gaaaagatcaccactgtcaaagcggcgatcgactacgcccaaagcaaaaaggcttga

DBGET integrated database retrieval system