KEGG   Limnohabitans sp. TEGF004: LTEGF4_18950
Entry
LTEGF4_18950      CDS       T11140                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
limt  Limnohabitans sp. TEGF004
Pathway
limt00770  Pantothenate and CoA biosynthesis
limt01100  Metabolic pathways
limt01240  Biosynthesis of cofactors
Module
limt_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:limt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LTEGF4_18950 (coaD)
Enzymes [BR:limt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     LTEGF4_18950 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: BDU56214
LinkDB
Position
complement(1975508..1976005)
AA seq 165 aa
MSKQVVAIYPGTFDPISLGHEDIVLRAAAMFDKVILAVATAHHKKTLFTLDERMDMAREA
MAAHPQVEVVPFTGLARDFVRSHNATVMVRGVRTVTDFDYEFQLAGMNRELMPEVETVFL
TPSAKYQFISSTFVREISLLGAGDDGKDLVSAGVYKRLLAKRTAK
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtccaagcaagttgttgccatttaccccggcacctttgaccccatcagcttgggccat
gaagacatcgtgttgcgcgctgcggccatgtttgacaaggtcatcttggcggtggccact
gcccaccacaagaaaaccttgttcaccttggacgagcgcatggacatggcgcgtgaggcg
atggccgcacacccgcaagtcgaagtggtgcccttcaccggcttggcgcgcgactttgtg
cgtagccacaacgccaccgtgatggtgcgcggtgtgcgtaccgtgactgactttgattac
gagtttcaactcgccggcatgaaccgagagctgatgcctgaggtggaaaccgtgttcctc
acccccagcgccaaataccaattcatctccagcacctttgtgcgcgaaatctctttgctg
ggggccggtgatgatggcaaagacttggtgtctgcaggtgtgtacaagcggctgttagcc
aagcgcacggcgaagtga

DBGET integrated database retrieval system