Limnohabitans sp. TEGF004: LTEGF4_20120 Help Entry LTEGF4_20120      CDS       T11140                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism limt  Limnohabitans sp. TEGF004 Pathway limt01100   Metabolic pathways limt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:limt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LTEGF4_20120 (acpP)    00074 Mycolic acid biosynthesis     LTEGF4_20120 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LTEGF4_20120 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  BDU56331 LinkDB All DBs Position complement(2080723..2080962) Genome browser AA seq 79 aa AA seqDB search MSDIELRVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKINTVQNAIDYALTHKKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaactgcgtgtcaaaaaaatcattgctgaacaactcggcgttgaagag tctcaagttaccaacgaaaaagccttcgtggccgatttgggtgctgactccctggacaca gtggaattggtgatggcattggaagatgagtttggtattgaaatcccagacgaagatgcc gaaaaaatcaacaccgtgcaaaacgcgattgactacgcgttgacccacaaaaaagcctaa

DBGET integrated database retrieval system