Listeria innocua (serotype 6a): lin1940 Help Entry lin1940           CDS       T00067                                  Name (GenBank) lin1940   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism lin  Listeria innocua (serotype 6a) Pathway lin03020   RNA polymerase Brite KEGG Orthology (KO) [BR:lin00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     lin1940  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:lin03021]     lin1940    03400 DNA repair and recombination proteins [BR:lin03400]     lin1940 Enzymes [BR:lin01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      lin1940 Transcription machinery [BR:lin03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      lin1940 DNA repair and recombination proteins [BR:lin03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       lin1940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  CAC97170 Pasteur:  LIN01940 UniProt:  Q92AI2 LinkDB All DBs Position complement(1956686..1956889) Genome browser AA seq 67 aa AA seqDB search MLYPSIDNLLLKIDSKYSLVTVAAKRARYMQLENDKGVLPSYQSDKFVGKALEEIHAGKL VLQNDEK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgttatatccatcaattgataatttattgctaaaaatcgactcaaaatattcgctagtt actgtggctgctaaacgtgcgcgctacatgcaattagaaaacgataaaggtgtattacca agctaccaatctgataaatttgttggtaaagcgttagaagaaattcacgctggaaaatta gttttacaaaacgacgagaaataa

DBGET integrated database retrieval system