Leucobacter insecticola: G7067_00580 Help Entry G7067_00580       CDS       T07184                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism lins  Leucobacter insecticola Pathway lins03060   Protein export lins03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:lins00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     G7067_00580  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     G7067_00580  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:lins02044]     G7067_00580 Secretion system [BR:lins02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    G7067_00580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  QIM15250 UniProt:  A0A6G8FFQ2 LinkDB All DBs Position complement(123840..124052) Genome browser AA seq 70 aa AA seqDB search MLGNLNGPTLFVILFIVLLLFGAPKLPGLAKSLGQSMRILKKEVRSNDAEKPDAAADGTS DAEKPESDKK NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgcttggaaacttgaacggcccaacgctgttcgtcatcctcttcatcgtgctgctgttg ttcggtgcgccgaagcttccggggctcgcgaagagcctgggccagtcgatgcggatcctg aagaaggaagttcgttccaacgacgcggagaagcctgacgccgccgctgacgggacatcc gacgcggaaaagcccgagtccgacaaaaagtag

DBGET integrated database retrieval system