Lawsonia intracellularis N343: LAW_00161 Help Entry LAW_00161         CDS       T02437                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lir  Lawsonia intracellularis N343 Pathway lir01100   Metabolic pathways lir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lir00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LAW_00161    00074 Mycolic acid biosynthesis     LAW_00161   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LAW_00161 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AGC49562 LinkDB All DBs Position complement(200561..200800) Genome browser AA seq 79 aa AA seqDB search MSVEEKVKKIIIEQLGVSAEEIKPEASFIEDLGADSLDLTELIMAMEEAFDLEIADEDAQ KILTVKDAIDYINSVQDNV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtctgttgaagaaaaagtcaaaaaaataattatagaacaacttggtgtttctgctgaa gaaataaagcctgaagcatcgtttatagaagatttaggagcagactctcttgacttaaca gaactaattatggctatggaagaagcttttgatcttgaaattgctgatgaagatgcacaa aaaattcttacagtaaaagatgctattgattatattaatagtgtacaggacaatgtctag

DBGET integrated database retrieval system