Lawsonia intracellularis N343: LAW_00817 Help Entry LAW_00817         CDS       T02437                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism lir  Lawsonia intracellularis N343 Pathway lir00020   Citrate cycle (TCA cycle) lir00720   Other carbon fixation pathways lir01100   Metabolic pathways lir01110   Biosynthesis of secondary metabolites lir01120   Microbial metabolism in diverse environments lir01200   Carbon metabolism lir01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:lir00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LAW_00817   09102 Energy metabolism    00720 Other carbon fixation pathways     LAW_00817 Enzymes [BR:lir01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LAW_00817 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_10 Fer4_16 Fer4_2 Fer4_6 Fer4_9 Fer4_4 Fer4_13 Fer4_8 Fer4_3 Fer4_22 Fer4_17 Fer4_15 Motif Other DBs NCBI-ProteinID:  AGC50212 LinkDB All DBs Position 984088..984318 Genome browser AA seq 76 aa AA seqDB search MSHIEIIEERCKGCLLCTDACPKQLIRQSTKLNKQGYKVSEFIEGGELTCIGCTACAVMC PDAAIRVFRTRKVKSK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtcacatattgaaattattgaagaacgttgtaaagggtgtttattatgtacagatgca tgccctaaacagttgattcgtcaatctacaaaacttaataaacaaggatataaagtttca gagtttatagaaggtggagagttaacttgtataggctgtacagcttgtgctgttatgtgt cctgatgccgcaatacgagtttttcgaactcggaaggtaaaaagtaagtag

DBGET integrated database retrieval system