Qingshengfaniella alkalisoli: FPZ52_04200 Help Entry FPZ52_04200       CDS       T06129                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lit  Qingshengfaniella alkalisoli Pathway lit01100   Metabolic pathways lit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lit00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPZ52_04200    00074 Mycolic acid biosynthesis     FPZ52_04200   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPZ52_04200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QDY68912 UniProt:  A0A5B8IRT4 LinkDB All DBs Position 815319..815552 Genome browser AA seq 77 aa AA seqDB search MSDVAERVKKIVVEHLGVEADKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIKEAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgctgaacgcgtgaagaagatcgttgtcgagcatctgggtgtcgaagcg gacaaggtaactgaaagtgcctcgttcatcgacgatctgggtgccgacagcctggacacc gtcgaactggtgatggctttcgaagaagagttcggcatcgagatcccggacgacgcagcc gagacgatccagaccttcggcgatgcggtcaagttcatcaaggaagccgcgtaa

DBGET integrated database retrieval system