Qingshengfaniella alkalisoli: FPZ52_12740
Help
Entry
FPZ52_12740 CDS
T06129
Name
(GenBank) C-terminal binding protein
Organism
lit
Qingshengfaniella alkalisoli
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
2-Hacid_dh_C
2-Hacid_dh
NAD_binding_2
KARI_N
AdoHcyase_NAD
F420_oxidored
NAD_binding_7
RS_preATP-grasp-like
UDPG_MGDP_dh_N
GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID:
QDY70562
UniProt:
A0A5B8IWP1
LinkDB
All DBs
Position
unnamed1:285849..286886
Genome browser
AA seq
345 aa
AA seq
DB search
MASFHILTPDAQYADDATVERAVAGSQAKWSIFRERDAAKISKDVWKNCDALVVWHEMPL
DAQTIARLDRCKIIVRAGVGFDHIDLEAAADRGIPVCNTPDYGTSEVADHAIAMMLNFKR
GLTSYHGHLQRAPGDGFNFRLAPLTGRLRGKTLGIVGLGRIGAATALRAKAFGMNVICFD
PHVSRGAEIAVGVGRVESLDELLAASDVVSLHCPLTSETRNMINDAALKMMRPDALLINT
ARGAIVDVPALLSALRRREIAGAALDVLPSEPPEPTDAIAVEYGDPESSLAGERLLLSPH
AAWSSPESVEDARRLAVETALIYLREGRLRNLVNNPTERSEIEAA
NT seq
1038 nt
NT seq
+upstream
nt +downstream
nt
atggcgagttttcatatcctgacccccgatgcccagtatgcggatgatgccacggtcgaa
agggcggtcgcgggatcacaggcaaagtggagcatcttcagggaacgtgacgcggccaag
atatccaaggacgtttggaagaactgcgatgcgcttgttgtctggcatgaaatgccgctg
gatgctcagacgattgcccgccttgatcgctgcaaaatcattgttcgggccggcgttggc
ttcgatcatatcgatctggaggctgccgccgaccgaggcatccccgtgtgcaacacacca
gattacggcaccagcgaggtcgcggatcacgccatcgccatgatgctgaatttcaagcgc
ggcctgaccagctatcacgggcacctgcaacgtgcgccaggggatgggttcaatttcagg
ttggcgcctttgacggggcgcctgcgcggcaaaacacttggtatcgtcggtttagggcgg
atcggcgcggcgacggctttgcgggccaaagcattcggaatgaacgtgatttgtttcgat
ccccatgtctcgcggggggcggagattgcggtcggtgttggacgggttgaaagtctggat
gaacttctggccgcgagtgatgtggtcagtttgcattgcccgctgaccagcgaaaccagg
aacatgatcaatgatgccgcgctgaaaatgatgcgcccagatgccttgctgatcaacaca
gcccgcggtgcgatcgtggatgtccccgctcttctctcggcactgcgacgccgcgaaatt
gccggggcggcgctggacgtcttgccttcggagccgccggagccgacagacgcaatcgcg
gtcgaatatggcgatccggaaagttcactcgcaggagaacggcttttactgtcaccgcat
gcggcctggtccagtccggaaagtgtggaagacgcgcggcgcttagccgttgaaaccgcg
ctgatttacctgcgcgagggccgcctgcgcaatctggtcaataatccgacggaaagatcg
gaaatcgaggcggcatga
DBGET
integrated database retrieval system