KEGG   Qingshengfaniella alkalisoli: FPZ52_15045
Entry
FPZ52_15045       CDS       T06129                                 
Name
(GenBank) amino acid adenylation domain-containing protein
  KO
K02364  L-serine---[L-seryl-carrier protein] ligase [EC:6.3.2.14 6.2.1.72]
Organism
lit  Qingshengfaniella alkalisoli
Pathway
lit01053  Biosynthesis of siderophore group nonribosomal peptides
lit01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lit00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    FPZ52_15045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:lit01008]
    FPZ52_15045
Enzymes [BR:lit01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.72  L-serine---[L-seryl-carrier protein] ligase
     FPZ52_15045
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     FPZ52_15045
Polyketide biosynthesis proteins [BR:lit01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    FPZ52_15045
SSDB
Motif
Pfam: AMP-binding Condensation Thioesterase PP-binding AMP-binding_C Abhydrolase_1 Abhydrolase_11 Abhydrolase_5 Abhydrolase_3
Other DBs
NCBI-ProteinID: QDY71031
UniProt: A0A5B8J1H1
LinkDB
Position
unnamed3:complement(2802..6629)
AA seq 1275 aa
MRDMPARWPLCAAQDGIWYAQTGAPDSPAFNTGQALDLRGTLDVTALQTAVNQTAAEAQS
LALRFAGTPDGPVQWLASNGSPRLAHRDLSHAPDPSATAWSAIWNELHDPINLSDGPVAG
FTLWRLAPDYHILSQWMHHLVADGYTNVLISNRIAELYNAARDGHVPGPAFAPFDRIRDT
EGGYDTSTRRDTDRSYWHSRLSGIETMGEIKPGPARFSDGFHRAEIALAAEDRHALQSLA
DRADTSWPDVLTALTTAYYARHISEGQAVPGIPLMNRMGKPARAPGTMVNVLPLVVEIDE
ATPLDDWLRTAASALSDLRRHGRYRGEVLRRELKLVGGTKRLHGPLINVLPFDPTPRFDG
LKTELTITGAGSVDDLTFTFRGTGKSGLMLQCDANPARYNSEEVEAHLARLHAFIRNATH
AQRLSDIPTLTADERHLHVVTRNITTKHVPDTTLSALIEARLRDTPERTALVFDDDTMTF
ADVDHRSAALAAQLQTHGVGPEVRVAIALPRSFDLLIALIAVLRAGGTYVPLDPNDRSER
STDMLRRSEPVIVLAAPDYPAGAAQLLPPGEWQDHGQPTACATPDSAAYTLFTSGFTGRP
KGVVIEHRAIVNRLLWMRNHYDIGPKDRILQKTPATFDVSVWEFFLPLVSGATLVIAPPD
AHRDPARIAALIRRHDITALHFVPSMLALFLASPDAQKLRIRHVFSSGEALPTEMARRFH
QTIDGQLHNLYGPTEAAIDVSFFEATGDHHVQSVPIGTPVWNTRLYVLDGQLRPVPDGVA
GTLYIAGQQLARGYLGQPELTAERFLPDPFHPSERMYDTGDLAYMRCDDAIVFIGRRDQQ
VKIRGVRIELGEIETAILRTGLAQNCVLRTDQDSGTTRLIAYAVLQGGVDTHQLRDELQH
RLPPSMQPHVIVPLSTLPLTPNGKLDHKALPTPNVLAEPTRPLADGTETLLGRLYAEALD
LPRPASPDTDFFAAGGDSLSAVQLTLLIEQEIQHNPGLGAILETPVLSALARQIDGAKQV
NDGLGPVLNIAEGREPAFFAIHPAGGLAWCYRGLAQRMKHRVVGLQSPLLDATREAPQSL
TALAKEYSDRIETLAPNGPINLLGWSLGGIIAHAAATELQSRQRQIGTVALLDAYPSNCW
RDQPEPDEATALGGLLAIAGFNPDQFSHLKGRDAIIGFLRDQSHPLALLPNPVIDGVIRS
VQQVNRLVREHREARYDVPVHHIYAARDHAGTPFHPELWRPYAASIDVLELTCGHADLIA
APYSQQVANHIGHTA
NT seq 3828 nt   +upstreamnt  +downstreamnt
atgagggacatgcccgcccgttggcccctttgcgccgcacaggatggcatctggtatgcg
cagacgggcgcacccgacagccccgcgttcaacaccggacaagcccttgatctgcgcgga
accctggatgtcaccgcgctacagacagcggtcaatcaaacggcggcggaggcccagtcg
ctcgccctacgctttgcaggcacgcctgacggtccggttcaatggctggcgtcgaacgga
tcccctcgcctggctcatcgcgacttgtcgcatgcccccgacccaagcgccaccgcatgg
tcggccatatggaacgagcttcacgacccgatcaacctgtccgacggccccgtcgccggc
tttaccctgtggcgtctcgcgcccgattaccacatcctcagccagtggatgcaccatctg
gtcgctgacgggtacacgaacgtcctgatctccaatcgtatcgcggaactttacaacgcc
gcacgcgacggccacgtacccggccccgctttcgcgccctttgaccgcatccgcgatacc
gaggggggctatgatacatctacgcgccgggacaccgaccgcagctactggcatagccgc
ctcagcggaatcgagaccatgggcgagatcaaacccggccccgcccgtttttccgacggc
ttccaccgcgcagaaatcgcgctggccgcagaggatcggcacgcgctgcaatcgctggct
gatcgcgcggatacaagctggcccgacgtgctaaccgcgttgaccaccgcctattatgcc
cgccacatcagcgaaggtcaggctgtccccggtattccgctgatgaatcgcatgggcaaa
ccggcccgcgcgccggggacgatggttaatgtgctgcctctagtagtcgaaatcgacgaa
gcaacgccgctggacgattggctgcggacagcagcttccgccctgtccgacctgcgtcgt
cacggtcgttatcgcggcgaggtgctacgacgtgaactgaaactcgtcggcggtaccaag
aggctgcacggtccattgatcaatgttctgcccttcgacccgaccccgcgcttcgacggg
ctgaaaacggaactgacgataaccggcgcagggtcggtcgatgacctgaccttcaccttc
cgtggcacgggaaaatccggcctgatgctgcaatgcgatgcaaacccggcccgctataat
agtgaagaggtcgaggcccacctcgcccgcctgcacgcgttcatccgaaatgccacgcat
gcacaacgcctgtccgacatacccaccctcacggcagacgaacgtcacctccatgtcgtc
acccgcaacatcacgacgaagcacgtgccagacacgacgctctccgcgctaatcgaggct
aggctgcgcgacaccccggaacgaaccgcactggtcttcgacgacgacacgatgacgttt
gccgatgtcgaccaccgcagcgccgctcttgccgcgcagcttcaaacgcacggagtcggg
ccggaggtgcgcgtcgccatcgccctgccccgctctttcgacctgttgatcgcgctgatc
gccgttttgcgtgctggtggcacctatgtgccgctcgaccccaatgaccggtccgaacga
tccaccgatatgctcaggcgatccgagccggtgatcgtgctggccgcaccggattacccc
gccggtgctgcgcaacttttgccccccggtgaatggcaggaccacggccagcccaccgcc
tgcgccacccccgacagcgccgcctacacactgttcacttccggtttcactgggcgtcca
aaaggcgtcgtgatcgagcaccgcgccattgtgaaccggttactttggatgcgcaatcat
tacgatatcggccccaaggatcgtatcctgcagaagacccccgcgacctttgatgtgtcg
gtctgggaattcttcctgccgctggtctcaggtgccacgctggtgatcgccccgccggat
gcccatcgcgaccccgcacggatcgccgcgctgatccgccggcatgacatcaccgcgcta
catttcgtgccctcgatgctggcgctgtttcttgcatcgcccgatgcacagaaacttcgc
atccgccacgttttcagtagcggcgaggcgctgcccacggaaatggccagacggtttcat
cagaccatcgacgggcagttgcacaatctatacggccccaccgaagctgccatcgacgtt
tcctttttcgaggcaacaggggatcatcacgttcagtctgttccgatcggcacgcccgtc
tggaacacgcgtctctatgtgctggatggtcagttgcgacccgtgccggatggggttgcg
ggcacactctacatcgccggtcagcaactggcacgtggttatctcggccagcccgagctc
accgccgaacgcttcctgcccgatccgttccaccccagcgagcggatgtatgacaccggc
gatctggcctatatgcgttgcgacgacgccatcgttttcattggtcgccgcgatcagcag
gtcaagatcaggggggtgcgcattgaattgggcgagatcgaaaccgccatcctccgcacc
gggctcgctcaaaactgcgtgcttcgcacggatcaggatagcgggacgacccgcctgatc
gcctacgcggtgttgcaaggcggtgtagacacccaccagttgcgtgacgagctacaacac
cgcctacccccttccatgcagccgcatgtaattgttccgctatcgaccctgccactgaca
ccgaacggcaagctggatcacaaggccctgccgacaccgaatgtgttggccgaaccaaca
cgcccactggccgacggaaccgagacgcttctcggtcgtctctacgccgaagcgcttgac
ctgccccgcccggcgtcacctgataccgatttcttcgctgccggtggcgactcgctttca
gccgttcagctcacactgctgatcgaacaggaaattcaacataatcctggtcttggggcg
atcctggaaacccccgtcctctcggctctcgcccgccagatcgatggcgccaaacaggtc
aatgacggtcttggtccagtactgaatattgccgaagggcgcgagccggctttctttgcc
attcatcccgccggcggccttgcatggtgctatcgcggattggcacagcggatgaaacac
cgcgtggttggtctgcaatctccgcttctcgacgccacccgcgaggcaccgcagagcctg
accgcccttgccaaggaatacagcgaccggatcgagacgctggcccctaacggcccaatc
aacctgcttggctggtcactgggcgggattattgcgcatgccgccgccactgagctgcag
tctcgccaacggcagatcgggacggtagcgctgctcgatgcctacccctccaattgctgg
cgcgatcagcccgagccggatgaagccaccgcgctcggggggttgttggcgatcgccggt
ttcaaccctgaccaattttctcacctgaaaggccgcgatgcgatcatcggatttttacgc
gaccagagccatccgctagcgctgttgccaaacccggtgatcgacggcgtcatccggtcg
gtgcagcaggtcaaccgcctcgttcgcgagcaccgagaagcgcgctacgatgttcccgtt
caccacatctacgccgcaagggatcatgcgggaactccattccaccctgagctttggcga
ccttatgcagcatccattgatgtgctggaacttacctgtggacatgccgatctgattgcg
gcaccctacagtcagcaggtggcgaaccacataggtcacacggcttag

DBGET integrated database retrieval system