Lichenihabitans sp. PAMC28606: LGH83_03075 Help Entry LGH83_03075       CDS       T07621                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism liz  Lichenihabitans sp. PAMC28606 Pathway liz01100   Metabolic pathways liz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:liz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LGH83_03075    00074 Mycolic acid biosynthesis     LGH83_03075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LGH83_03075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  UDL95233 LinkDB All DBs Position complement(652892..653131) Genome browser AA seq 79 aa AA seqDB search MSDVAERVKKIVVEHLGVEPEKVVDNANFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETIVTVGDAVRFLEKNKKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgccgagcgcgtaaagaagatcgtggttgaacatctcggcgtcgagccg gaaaaggttgtcgataacgctaatttcattgacgatcttggcgcagattcgctcgacacg gtcgaactcgtgatggccttcgaagaagagttcggtgttgaaatcccggacgatgcagcc gagacgattgtcacggtcggcgatgccgtccggttcttggaaaagaacaaaaaggcttaa

DBGET integrated database retrieval system