Lotus japonicus: 130718174 Help Entry 130718174         CDS       T04348                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism lja  Lotus japonicus Pathway lja03083   Polycomb repressive complex lja04120   Ubiquitin mediated proteolysis lja04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lja00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130718174    04120 Ubiquitin mediated proteolysis     130718174   09126 Chromosome    03083 Polycomb repressive complex     130718174  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lja04131]     130718174    04121 Ubiquitin system [BR:lja04121]     130718174    03036 Chromosome and associated proteins [BR:lja03036]     130718174 Membrane trafficking [BR:lja04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     130718174 Ubiquitin system [BR:lja04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      130718174    Cul7 complex      130718174 Chromosome and associated proteins [BR:lja03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      130718174   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      130718174 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB DUF3932 Motif Other DBs NCBI-GeneID:  130718174 NCBI-ProteinID:  XP_057424671 LinkDB All DBs Position 5:1500679..1501474 Genome browser AA seq 134 aa AA seqDB search MASTARKITLKSSDGAAFEVEEAVVALHSQTIKDMINAHSGIVALSDVTGNILAKVIQYC NKHSSGSENELRQWDADFVKVDRDTLFDLLNAANNLKIKSLLNLIVHTVAQMMKGMNPQE ICELTMRMSGFRLS NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggcttcaacagcgaggaagatcaccctgaagagttccgatggtgcggccttcgaagtg gaagaagcggtggtggcgcttcactcacagaccattaaggacatgatcaacgcccacagc ggcatcgtcgctctttccgatgtaaccggcaacatcctcgccaaagtgatccagtattgc aacaagcacagttccggtagcgagaatgagctccggcaatgggatgctgatttcgtgaag gttgatcgggacacgctcttcgatctcctcaatgctgcaaacaatttgaagatcaagagc cttttgaaccttattgttcataccgtagcacagatgatgaagggtatgaatcctcaggaa atttgcgagttaacaatgagaatgagtggttttagactcagttga

DBGET integrated database retrieval system