Lotus japonicus: 130735704 Help Entry 130735704         CDS       T04348                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism lja  Lotus japonicus Pathway lja03083   Polycomb repressive complex lja04120   Ubiquitin mediated proteolysis lja04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lja00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130735704    04120 Ubiquitin mediated proteolysis     130735704   09126 Chromosome    03083 Polycomb repressive complex     130735704  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lja04131]     130735704    04121 Ubiquitin system [BR:lja04121]     130735704    03036 Chromosome and associated proteins [BR:lja03036]     130735704 Membrane trafficking [BR:lja04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     130735704 Ubiquitin system [BR:lja04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      130735704    Cul7 complex      130735704 Chromosome and associated proteins [BR:lja03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      130735704   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      130735704 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 DarP Motif Other DBs NCBI-GeneID:  130735704 NCBI-ProteinID:  XP_057443597 LinkDB All DBs Position 2:complement(77229013..77230713) Genome browser AA seq 131 aa AA seqDB search MASTRMITLKSSDGEAFEVEEAVALQLGCIEHMIKADCADNSNIDLPSVTGRIFAKVIEY CKKHVDASRSGIEDLKQWDADFVKVDVPTLKDLVKAANALDIKNLLNLTCETVELMIRNK TPDQIRKIFLL NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcatctacaagaatgatcaccctaaagagttctgacggtgaggcgttcgaggtcgag gaggctgtggcgcttcagttggggtgcatagagcacatgattaaggctgattgcgccgat aacagcaatattgatcttccaagtgtcaccggcaggatattcgccaaggttattgaatac tgcaaaaaacacgttgacgcttcccgttcaggcatcgaggatctcaagcaatgggatgct gatttcgtcaaggttgatgtgcccacgctcaaggatctcgtcaaggctgcaaatgctttg gacataaagaaccttttgaatctcacttgcgagactgtggaactcatgatcagaaataag actcctgatcaaattaggaaaatctttcttctttag

DBGET integrated database retrieval system