KEGG   Lotus japonicus: 130742825
Entry
130742825         CDS       T04348                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
lja  Lotus japonicus
Pathway
lja00220  Arginine biosynthesis
lja00250  Alanine, aspartate and glutamate metabolism
lja00270  Cysteine and methionine metabolism
lja00330  Arginine and proline metabolism
lja00350  Tyrosine metabolism
lja00360  Phenylalanine metabolism
lja00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lja00710  Carbon fixation by Calvin cycle
lja00950  Isoquinoline alkaloid biosynthesis
lja00960  Tropane, piperidine and pyridine alkaloid biosynthesis
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
lja01200  Carbon metabolism
lja01210  2-Oxocarboxylic acid metabolism
lja01230  Biosynthesis of amino acids
Module
lja_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
lja_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    130742825
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    130742825
   00270 Cysteine and methionine metabolism
    130742825
   00220 Arginine biosynthesis
    130742825
   00330 Arginine and proline metabolism
    130742825
   00350 Tyrosine metabolism
    130742825
   00360 Phenylalanine metabolism
    130742825
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    130742825
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    130742825
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    130742825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lja01007]
    130742825
Enzymes [BR:lja01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     130742825
Amino acid related enzymes [BR:lja01007]
 Aminotransferase (transaminase)
  Class I
   130742825
SSDB
Motif
Pfam: Aminotran_1_2 PaO
Other DBs
NCBI-GeneID: 130742825
NCBI-ProteinID: XP_057450909
LinkDB
Position
3:complement(42661279..42674358)
AA seq 424 aa
MAIRNSLNGRFLRHSSVAGARFMSSWFRNIEPAPKDPILGVTEAFLADQSPNKVNVGVGA
YRDDNGKPVVLECVREAERRIAGSQFMEYLPMGGSIKMVEESLKLGYGENSQFINDKQIA
AVQALSGTGACRLFAAFQQRFHPNTQIYIPVPTWANHHNIWRDAGVPLKTFRYYHPESRG
LDFSGLMEDIKNAPDGSFFLLHACAHNPTGVDPTEEQWREISSQIKAKGHFPLFDMAYQG
FASGNPERDAKAIRIFLEDGHLIGLAQSFAKNMGLYGQRVGCLSLLCENEKQAVAVKSQL
QLISRPMYSNPPLHGALIVSTILGDPELKTLWLKEVKVMADRIIGMRTTLRDNLEKLGSP
LPWQHITNQIGMFCYTGLTPEQVDRLTNEFHIYLTRNGRISMAGINSGNVAYVANAINEV
TKSS
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcgatccgcaactcgctcaacggtagattcctccgccacagctccgtcgccggagct
aggttcatgtcgtcgtggttccggaacatcgagccagctcccaaggacccgatcctcggt
gttaccgaagcttttcttgccgatcagagtccaaacaaagtcaatgtcggagtgggagcg
tatcgcgatgacaatggaaaacctgtggttctggaatgtgttagggaagcagagaggagg
attgcaggaagccaattcatggagtatcttcctatgggtggaagcataaagatggttgaa
gaatcactgaagctgggatatggtgaaaactctcagttcatcaatgataaacaaatagct
gctgtgcaggctttatctgggactggtgcatgtcgactttttgctgcatttcaacagcgt
tttcaccctaacacacaaatttatataccagtgcccacctgggccaaccaccataacatt
tggagagatgctggagtgcctttgaaaacattccgttactatcaccctgagtctagagga
ctggatttttcagggctgatggaagacataaagaatgctcctgatggttccttctttctg
cttcatgcttgtgctcacaatcctactggagtagatcctacagaagaacaatggagagag
atctcttcccagatcaaggctaaaggtcatttccctttatttgacatggcatatcaaggt
tttgctagtggcaatccagagagagatgcgaaagccatcaggatttttcttgaagatggt
catttaataggacttgctcagtcttttgcaaaaaatatgggattgtatggccagcgagtt
ggatgccttagcttactttgtgaaaatgagaaacaagctgttgctgtaaaaagtcagttg
cagctgatttccagacccatgtacagtaacccacctcttcatggagcacttatagtttca
accattcttggtgatccagagttaaagacgttatggcttaaagaagttaaggttatggca
gatcgtatcattggaatgaggaccacactccgtgataacttagaaaagctgggttctcct
ttgccatggcagcacataaccaatcagattggaatgttctgctacactgggttgacacca
gaacaggttgatcgtttgacaaacgagtttcatatttacttgactcgcaacggtcgtatc
agtatggctggaattaattcggggaacgttgcatatgtggctaatgctatcaacgaggtc
actaaatcttcctag

DBGET integrated database retrieval system