KEGG   Lactobacillus johnsonii NCC 533: LJ_0713
Entry
LJ_0713           CDS       T00158                                 

Definition
(GenBank) probable glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00220  Arginine biosynthesis
ljo00250  Alanine, aspartate and glutamate metabolism
ljo00471  D-Glutamine and D-glutamate metabolism
ljo01100  Metabolic pathways
ljo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LJ_0713
   00220 Arginine biosynthesis
    LJ_0713
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LJ_0713
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LJ_0713
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     LJ_0713
SSDB
Motif
Pfam: Glutaminase
Other DBs
NCBI-ProteinID: AAS08531
UniProt: Q74KN9
LinkDB
Position
602185..603105
AA seq 306 aa
MIQLEKLVKKNLPKEKEGKVASYIPALAEVNPKQLGIALYDLEDGEVGEAGQSEVRFAIE
SISKVITLMLAIKKMGIQEVFKHVGSRQTGFAFNSILNMEIERAKYPLNPFINAGAIATT
SMVVSKTGDDAFEEILDFARDICNDPDLYLDQIIYHSERRTGNLDRSLAYYMESKNMMLG
DVVTSLDTYFKQCSMMVTARSLANLGAVLANGGVKPWDNKRIIPDEEARCIKSLMMTTGL
YNQSGTYSRLIGVPTKSGVGGGLMSAAPHKYGIGIFSPALDKDGNSIAGLDLLRDIVDGL
ELDIFD
NT seq 921 nt   +upstreamnt  +downstreamnt
atgattcaattagaaaaattggttaagaaaaatttacctaaagaaaaagaaggaaaagtt
gctagctatattccagctttagctgaagttaatcctaagcaactcggaattgccttatac
gatttagaagatggtgaagtaggtgaagcaggtcaaagtgaagtacgttttgcaattgaa
agtatttctaaggtgattaccttaatgcttgctattaaaaagatgggcatacaagaagta
tttaaacatgtaggctcccgtcaaacaggttttgccttcaattcaattctaaatatggaa
attgaaagagctaagtatccgttgaatccttttattaacgctggagcaattgctacaact
tcgatggtagtaagtaagactggtgacgatgcatttgaagaaattttagattttgctcgt
gatatttgtaatgacccagatctttacttagatcaaataatttatcattctgaaagaaga
acaggcaatctagatcggtcattagcatattatatggaatctaaaaacatgatgctcgga
gatgtagtaactagtcttgatacttactttaagcaatgttcaatgatggtgactgcacgt
tctttagcaaatttaggggctgttttggctaatggtggtgtaaaaccatgggacaacaaa
cgcattattcctgatgaagaagcaagatgtattaagtcattgatgatgaccaccggtcta
tataatcaatcaggaacctattcacgactaattggtgtaccaacaaagagtggtgttggc
ggtggtcttatgtctgctgcacctcataaatatggaattgggatctttagtccagcctta
gataaagatggtaacagtatcgcaggcttagatttgttgagagatattgttgatggatta
gagctggatatatttgattag

DBGET integrated database retrieval system