KEGG   Lactobacillus johnsonii NCC 533: LJ_0861
Entry
LJ_0861           CDS       T00158                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo00052  Galactose metabolism
ljo01100  Metabolic pathways
ljo01110  Biosynthesis of secondary metabolites
ljo01120  Microbial metabolism in diverse environments
Module
ljo_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0861
   00052 Galactose metabolism
    LJ_0861
Enzymes [BR:ljo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LJ_0861
SSDB
Motif
Pfam: Aldose_epim DUF3642
Other DBs
NCBI-ProteinID: AAS08682
UniProt: Q74K92
LinkDB
Position
762041..763027
AA seq 328 aa
MKTSFRKYSRKNGQDLCEISLENNQGMKVKILNYGATLEKVLLDGEDMILSLNSPEDYSK
ERNFLGGTVGRICGRVRLGQWKHGNQIYQLPQNDGENHIHGGIGTDMKIWNFKLKNSEQE
SRVDLFLFDPDGDNGYPGNMKLHATYKLDNENNLSYKLEAVSDQLTIFNPANHTYFNLGE
RATDLKLQLAADYYLPVGTDGLPNQGMKNVENTVFDFRQGKKISAALDSDDSQINLRNGL
DHPFILNGMQPAAVLSSNKHKMIMTTNAPAIVTYTANHFNHTGVANNIGQYDGITLEAQY
PPAEGIELGEITLLPFEKFERKINWNFS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgaaaacaagttttagaaagtatagtcgtaaaaatggtcaggacttatgtgaaattagt
cttgaaaataatcaaggaatgaaggttaagattcttaattatggagcaactttagaaaaa
gttctacttgatggcgaagatatgattttgtcattaaatagtccagaagattattcaaaa
gaaagaaattttctgggtggaaccgttggcagaatttgtggacgcgttcggctaggtcaa
tggaaacatggcaaccaaatatatcaacttcctcaaaatgatggagaaaaccacattcat
ggtggtattggaactgatatgaaaatctggaactttaaattaaaaaattcagaacaagag
tctcgagttgatctctttctttttgatccagatggagataatggctatcccggcaacatg
aagttacatgccacttataagcttgataatgaaaataacttgtcatacaaattagaagct
gttagtgatcagttaacaatttttaatccggctaatcatacatatttcaacttaggtgaa
agagctaccgacttaaaactccaacttgcagcggattactatttgccagtaggtacggat
ggattgccaaatcaaggaatgaaaaatgtagagaatacagtgtttgattttagacaaggt
aagaagatatctgctgctttagatagtgatgatagtcaaattaacttgcgtaacggtcta
gatcatccttttattttgaatgggatgcagcctgcagcagtgttgtcatctaataaacac
aaaatgattatgaccactaatgcaccagcaattgttacttatacagctaaccattttaat
catactggtgtagcaaacaatattggacagtacgatggaattactttagaagcacaatat
ccaccagcagaaggtatagagttaggagaaattactttactcccttttgaaaagtttgag
cgtaagattaactggaactttagttaa

DBGET integrated database retrieval system