KEGG   Lactobacillus johnsonii NCC 533: LJ_0924
Entry
LJ_0924           CDS       T00158                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo00030  Pentose phosphate pathway
ljo00500  Starch and sucrose metabolism
ljo00520  Amino sugar and nucleotide sugar metabolism
ljo01100  Metabolic pathways
ljo01110  Biosynthesis of secondary metabolites
ljo01120  Microbial metabolism in diverse environments
ljo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0924
   00030 Pentose phosphate pathway
    LJ_0924
   00500 Starch and sucrose metabolism
    LJ_0924
   00520 Amino sugar and nucleotide sugar metabolism
    LJ_0924
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ljo04147]
    LJ_0924
Enzymes [BR:ljo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     LJ_0924
Exosome [BR:ljo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LJ_0924
  Exosomal proteins of other body fluids (saliva and urine)
   LJ_0924
  Exosomal proteins of colorectal cancer cells
   LJ_0924
SSDB
Motif
Pfam: PGI DUF730
Other DBs
NCBI-ProteinID: AAS08745
UniProt: Q74K31
LinkDB
Position
824860..826203
AA seq 447 aa
MSKVVHFDASKLTPFVHENELKEMQAMVTAADQELREGTGAGSDFRGWIDLPINYDKDEF
DRIKKAAKKIQNDSEVLVGIGIGGSYLGAQASIEFLNSSFYGREKEKYPTVVFCGNSLSG
SYLYDLLEWLGDKDFSINIISKSGTTTEPSIAFRVLKDKLIKKYGKEEAAKRIYATTDRA
KGALKTEADAEGYEEFVVPDDIGGRFSVLSAVGLLPIAVAGGDIDAMMKGAADARAAYTD
PDVLKDSPYQYAAMRNILYRKGYTTELLENYEPSLRMFGEWWKQLMGESEGKDQKGIYPS
SANFTTDLHSLGQYIQEGRRNLMETVIRVEHPTHDVTIPDDKENLDQLNFLSGKTMNYVN
DRAYEGVVLAHTDGGVPVMTVDIENQTAHTLGYLIYWFELAVGISGYLNGINPFNQPGVE
SYKRNMFGLLNKPGYEDLHDDLTKRLK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagtaaagttgttcactttgatgcaagtaaattaactccttttgttcatgaaaatgaa
ttaaaggaaatgcaagcaatggtaactgctgcagatcaagaattacgcgaaggtactggc
gcaggtagtgacttccgtggttggattgatttgccaattaattatgataaagacgaattt
gatcgtattaaaaaagcagctaaaaagattcaaaatgattcagaagttttagttggtatt
ggtattggtggttcataccttggtgcccaagcttcaattgagttcttaaatagctctttc
tacggtagagaaaaagaaaagtacccaactgtagtattttgtggtaattctctttcaggt
tcatacctttacgatttgcttgaatggttaggagataaggacttttcaattaatattatt
tctaagtctggtactactactgaaccttcaattgctttccgtgtattgaaggataagtta
atcaagaaatacggtaaagaagaagctgctaagagaatttacgcaactactgaccgtgct
aagggtgctttgaagactgaagcagatgcagaaggttacgaagaattcgtagttccagat
gatattggtggtcgtttctcagtattgtcagctgttggtttgcttccaattgctgtagct
ggtggtgacatcgatgctatgatgaagggtgctgcagatgcacgtgctgcttacactgat
ccagatgttttaaaggacagtccttaccaatatgcagcaatgcgtaatatcctttaccgt
aaaggttacactactgaattacttgaaaactatgaaccatcattaagaatgtttggtgaa
tggtggaagcaattaatgggtgaatcagaaggtaaagatcaaaaaggtatttacccatct
agtgctaacttcactactgaccttcactcacttggtcaatacatccaagaaggtcgtcgt
aacttaatggaaacagttattcgtgttgaacacccaacacatgatgtaactattcctgac
gataaggaaaacctagatcaattaaacttcttatcaggtaaaactatgaattacgtaaat
gatcgtgcttacgaaggtgtagttctagctcatactgatggtggtgtaccagttatgact
gttgatattgaaaatcaaacagctcatactttaggttacttaatctactggtttgaatta
gctgtaggtatctcaggctacttaaatggtattaacccatttaaccaaccaggtgttgaa
agttacaagagaaacatgtttggtcttttaaacaaacctggttatgaagacttacatgat
gatttaactaaacgcttaaaataa

DBGET integrated database retrieval system