Liolophura japonica (common chiton): 135470109 Help Entry 135470109         CDS       T09976                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism ljp  Liolophura japonica (common chiton) Pathway ljp04137   Mitophagy - animal ljp04140   Autophagy - animal ljp04144   Endocytosis ljp04145   Phagosome ljp04148   Efferocytosis Brite KEGG Orthology (KO) [BR:ljp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     135470109    04145 Phagosome     135470109    04140 Autophagy - animal     135470109    04137 Mitophagy - animal     135470109    04148 Efferocytosis     135470109  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ljp04131]     135470109   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ljp04147]     135470109    04031 GTP-binding proteins [BR:ljp04031]     135470109 Membrane trafficking [BR:ljp04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     135470109 Exosome [BR:ljp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135470109   Exosomal proteins of other body fluids (saliva and urine)    135470109   Exosomal proteins of colorectal cancer cells    135470109   Exosomal proteins of bladder cancer cells    135470109 GTP-binding proteins [BR:ljp04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     135470109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA PduV-EutP ATP_bind_1 Septin cobW nSTAND3 AAA_16 NTPase_1 AAA_7 AAA_22 AAA_24 AAA_5 ATPase_2 G-alpha ATP-synt_ab NACHT NB-ARC AAA_14 Motif Other DBs NCBI-GeneID:  135470109 NCBI-ProteinID:  XP_064604937 LinkDB All DBs Position 7:40160568..40170260 Genome browser AA seq 205 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTMPNTFRTLDSWRDEFLIQASPRDPENFPF VVIGNKIDLENRAVSVKRAQGWCQSKGGIPYFETSAKEAINVEQAFQTVAKNALAQETEV ELYNEFPDQIKLSNQENKPKDGCGC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtcttctcggaagaaggttttactgaaagtcatcattctgggtgacagtggtgttggg aaaacctccttaatgaatcagtatgtcaacaaaaagtttagtaaccagtacaaggccact ataggtgcagacttcttgacaaaggaggtcatggtggaggaccggcttgtcacaatgcag atatgggacacagcaggacaggagaggttccagagtttgggtgtggcattttaccgaggg gctgactgttgtgtgctggtgtttgatgtcacaatgcccaatacattcagaacactagac agttggagagatgagttccttatacaggccagcccacgggacccagaaaacttcccattc gttgtaataggaaacaaaattgatttagaaaacagagcggtatctgtaaagagagcacag ggctggtgtcagagcaaaggaggaattccctactttgaaacaagcgcaaaagaagcaatc aatgtggaacaggcctttcaaacagtggccaaaaatgctttggcacaggagacagaggtg gagctgtacaatgaatttccagatcaaatcaaattgtccaatcaggaaaacaaacctaaa gatggctgtggatgttaa

DBGET integrated database retrieval system