Liolophura japonica (common chiton): 135475301 Help Entry 135475301         CDS       T09976                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism ljp  Liolophura japonica (common chiton) Pathway ljp03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ljp00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     135475301  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ljp03036]     135475301    03400 DNA repair and recombination proteins [BR:ljp03400]     135475301 Chromosome and associated proteins [BR:ljp03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      135475301 DNA repair and recombination proteins [BR:ljp03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      135475301 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa Bromo_TP DUF6062 CCDC-167 Amelotin Motif Other DBs NCBI-GeneID:  135475301 NCBI-ProteinID:  XP_064611212 LinkDB All DBs Position 9:12589667..12596218 Genome browser AA seq 132 aa AA seqDB search MDTTEDDQDLVLRQQLKAAVHYTVGKICEESEKDLNVKYHRQFIASLSEVTCKKIVSFAN DLELFSRHAKRSTVSPEDVKLLVRKSPRLHQHICDLHAELETQREETRKRGKKGKKKPSA QEDADEDSNMVD NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggatacaacagaagacgaccaagacttggtgctccgacagcaactcaaggctgctgtt cactacacagttgggaaaatctgtgaggagagcgagaaagacctcaatgtgaaatatcat cgacaattcatagccagtttatccgaagttacctgtaaaaagattgtctcatttgccaat gatctggagctgttttcaagacatgccaagagaagtacagtgtctccagaagatgtcaaa ctcttggtcagaaaaagccctaggctgcaccagcacatttgtgacttacatgctgagtta gagactcagagagaagaaacaaggaagcgagggaagaaaggaaagaaaaagcccagtgct caagaggatgctgatgaagattcaaacatggttgactga

DBGET integrated database retrieval system