Liolophura japonica (common chiton): 135476392 Help Entry 135476392         CDS       T09976                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism ljp  Liolophura japonica (common chiton) Pathway ljp04814   Motor proteins Brite KEGG Orthology (KO) [BR:ljp00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     135476392  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ljp03037]     135476392    04812 Cytoskeleton proteins [BR:ljp04812]     135476392 Cilium and associated proteins [BR:ljp03037]  Motile cilia and associated proteins   Dynein arm    135476392 Cytoskeleton proteins [BR:ljp04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      135476392 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 PTP2 Motif Other DBs NCBI-GeneID:  135476392 NCBI-ProteinID:  XP_064612472 LinkDB All DBs Position 1:complement(44598412..44605411) Genome browser AA seq 113 aa AA seqDB search MDDFQSAEETAFVVDEVSNIIKESIEGAIGGNAYQYNKVNQWTSNVVEQCLNQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSTDGSCTVRWENKTMYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgatttccagagcgctgaagagaccgcatttgtggtagatgaagtcagtaatatc atcaaagagtcaattgagggagccattggaggaaatgcttaccagtacaacaaagttaac cagtggacatcaaatgtggttgaacagtgcttaaatcaactcacaaagttgggtaaaccc ttcaaatatatagtgacttgtgttataatgcagaagaatggagcaggtcttcacacggcc agttcgtgtttctgggacaattccacagatggaagctgtacagtgaggtgggagaacaag acgatgtattgtattgtcagtgtgtttgggctggctatttga

DBGET integrated database retrieval system