KEGG   Legionella jordanis: NCTC11533_01877
Entry
NCTC11533_01877   CDS       T06275                                 
Symbol
clpS
Name
(GenBank) regulatory protein for ClpA substrate specificity
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
ljr  Legionella jordanis
Brite
KEGG Orthology (KO) [BR:ljr00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    NCTC11533_01877 (clpS)
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-ProteinID: VEH13014
LinkDB
Position
1:complement(2054832..2055155)
AA seq 107 aa
MSGWSLEEIVEREQAESEALPKLKQPRKYKVILLNDDYTPMEFVVEVLKRFFHLNEEVAT
QVMLQVHILGKGVCGIFTRDIAETKVALVNDHARSNQHPLLCTMEPE
NT seq 324 nt   +upstreamnt  +downstreamnt
atgagtggatggtctttagaggaaattgtagagcgagaacaggctgaatcggaagcctta
ccaaagctcaaacagcccagaaaatacaaagtaattctacttaatgatgattacacacca
atggaatttgtagtggaggtattaaagcgattctttcaccttaatgaagaggtagcaacc
caggtgatgttacaggttcatattttggggaagggcgtttgtggtatttttactagggat
atagcagaaacaaaagttgctttggtcaacgatcatgcgaggagcaatcaacaccccctg
ctatgtaccatggaaccagaatga

DBGET integrated database retrieval system