KEGG   Legionella jordanis: NCTC11533_02377
Entry
NCTC11533_02377   CDS       T06275                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase, iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
ljr  Legionella jordanis
Pathway
ljr00190  Oxidative phosphorylation
ljr01100  Metabolic pathways
ljr02020  Two-component system
Module
ljr_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:ljr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCTC11533_02377 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NCTC11533_02377 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    NCTC11533_02377 (petA)
Enzymes [BR:ljr01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     NCTC11533_02377 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: VEH13505
LinkDB
Position
1:complement(2565843..2566466)
AA seq 207 aa
MTDYNEPTPNENPTEDEIDEQRRKFLLTTTGIMGGVGVACALTPFVSSWWPSAQAQAAGA
PVQVDLSKMEPGQQVTVPWRGKPVWIIRRTKEMLQTLNKDESDLRDPQSLVEQQPSYAKN
QFRSINPEYLVLIGVCTHLGCSPKYMPNPNELGPNWPGGFYCPCHGSRFDLAGRVFKGVP
APINLAVPPYHFVSEHVIVIGEDKQEG
NT seq 624 nt   +upstreamnt  +downstreamnt
gtgacggactacaatgagcccactccgaatgaaaacccaaccgaagatgaaatcgatgag
caacgccgaaaatttttattgacaactactgggataatggggggcgttggtgtggcatgt
gccctcaccccctttgtttcttcctggtggccaagcgcgcaagcacaagccgcaggggct
ccagtgcaggttgatttaagtaaaatggagccagggcagcaagtcactgttccttggcgg
ggaaaaccagtttggattattcgccgcactaaagaaatgctgcaaacactgaataaggac
gagagtgatttgagggatcctcaatcccttgtcgagcaacagccttcctatgctaagaac
caatttcgttcgatcaatcctgagtatttagtgctaatcggagtttgtactcatttgggc
tgttcgccaaaatacatgcccaatcctaatgagctggggccaaattggccaggtggattt
tactgtccctgccatggttcacgctttgacttggctggccgagtgtttaagggggtgccg
gcgccgattaatttagcagttccgccctatcattttgtgagtgagcatgtgattgttatt
ggagaggataaacaagaaggatag

DBGET integrated database retrieval system