KEGG   Lentilactobacillus kefiri: DNL43_01490
Entry
DNL43_01490       CDS       T06710                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
lkf  Lentilactobacillus kefiri
Pathway
lkf00770  Pantothenate and CoA biosynthesis
lkf01100  Metabolic pathways
lkf01240  Biosynthesis of cofactors
Module
lkf_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lkf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DNL43_01490
Enzymes [BR:lkf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     DNL43_01490
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: QGV24044
LinkDB
Position
complement(274861..275337)
AA seq 158 aa
MTKALYAGSFDPITFGHIDVIKRASRMFDKVYVAISINTHKHALFTDEERADFARQALAG
IENVKVLVSEELTVKLAQSIGATVLVRGVRGGSDLDSEMSIAGLNEKLDNHIQTIFIPTA
ANYRDLSSSMIKEIAKFHGSVDKFVPEPVVRALNEKYR
NT seq 477 nt   +upstreamnt  +downstreamnt
atgacaaaagctttatatgcaggaagttttgacccaattacgtttggccacattgacgtt
attaaacgtgccagtcggatgtttgacaaggtctacgttgccattagtattaatacgcat
aagcatgctttgtttaccgatgaggaacgagcagactttgccagacaggccttggcggga
attgaaaacgttaaggtcttggtgtctgaagaattgacggttaagcttgctcaaagtatt
ggggcaactgtattggttcgcggcgtgcggggcggtagtgatttggattctgaaatgtcg
attgccggattgaacgaaaaattggacaatcatattcaaacaatttttattccaaccgct
gccaattaccgtgatctttcatccagcatgattaaagaaattgccaaattccatggtagt
gttgataaatttgttccagaaccggtggtaagggctttgaacgaaaagtaccggtaa

DBGET integrated database retrieval system